TAS2R39 Antibody

Name TAS2R39 Antibody
Supplier Novus Biologicals
Catalog NBP2-32560
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: ICTVYCNNSFPIHSSNSTKKTYLSEINVVGL
Purity/Format Immunogen affinity purified
Blocking Peptide TAS2R39 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene TAS2R39
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.