C19orf54 Antibody
| Name | C19orf54 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32485 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: HLVTGHPLLIPYDEDFNHEPCQRKGHKAHWAVSAGVLLGVRAVPSLGYTEDPELPGLFHPVLGTPCQPPSLP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C19orf54 Protein |
| Description | Rabbit Polyclonal |
| Gene | C19orf54 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: C19orf54 Antibody [NBP2-32485] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19658_C19orf54-Antibody-Immunohistochemistry-NBP2-32485-img0001.jpg)
Immunohistochemistry: C19orf54 Antibody [NBP2-32485] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferus ducts.
![Immunohistochemistry: C19orf54 Antibody [NBP2-32485] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19659_C19orf54%2520Antibody-Immunohistochemistry-NBP2-32485-img0002.jpg)
Immunohistochemistry: C19orf54 Antibody [NBP2-32485] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferus ducts.