RBM20 Antibody
| Name | RBM20 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34038 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ADWGNGRDSWEHSPYARREEERDPAPWRDNGDDKRDRMDPWAHDRKHHPRQLDKAELDERPEGGRPHREKYPRSGSPNLPHSVSSYKSRED |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RBM20 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RBM20 |
| Supplier Page | Shop |
![Immunohistochemistry: RBM20 Antibody [NBP2-34038] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/12452_RBM20-Antibody-Immunohistochemistry-NBP2-34038-img0001.jpg)
![Immunohistochemistry-Paraffin: RBM20 Antibody [NBP2-34038] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/12453_RBM20%2520Antibody-Immunohistochemistry-Paraffin-NBP2-34038-img0002.jpg)