B3GNT7 Antibody
| Name | B3GNT7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34016 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LGMCLEVLGVQPTAHEGFKTFGISRNRNSRMNKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLTCSRKLQVL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | B3GNT7 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | B3GNT7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: B3GNT7 Antibody [NBP2-34016] - Staining of human rectum shows strong granular positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/1963_B3GNT7-Antibody-Immunohistochemistry-NBP2-34016-img0001.jpg)
Immunohistochemistry: B3GNT7 Antibody [NBP2-34016] - Staining of human rectum shows strong granular positivity in glandular cells.