Lipin 3 Antibody
| Name | Lipin 3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31910 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SLDSENAALYFPQSDSGLGARRWSEPSSQKSLRDPNPEHEPEPTLDTVDTIALSLCGGLADSRDISLEKFNQHSVS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Lipin 3 Protein |
| Description | Rabbit Polyclonal |
| Gene | LPIN3 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Lipin 3 Antibody [NBP2-31910] - Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/12548_Lipin-3-Antibody-Immunohistochemistry-NBP2-31910-img0001.jpg)
Immunohistochemistry: Lipin 3 Antibody [NBP2-31910] - Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.
![Immunohistochemistry: Lipin 3 Antibody [NBP2-31910] - Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/12549_Lipin%25203%2520Antibody-Immunohistochemistry-NBP2-31910-img0002.jpg)
Immunohistochemistry: Lipin 3 Antibody [NBP2-31910] - Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.