RPP21 Antibody
| Name | RPP21 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31875 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: YQAAHCVLAQDPENQALARFYCYTERTIAKRLVL |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RPP21 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunohistochemistry: RPP21 Antibody [NBP2-31875] - Staining of human skeletal muscle shows moderate cytoplasmic and nuclear positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19646_RPP21-Antibody-Immunohistochemistry-NBP2-31875-img0001.jpg)
![Immunohistochemistry: RPP21 Antibody [NBP2-31875] - Staining of human skeletal muscle shows moderate cytoplasmic and nuclear positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19647_RPP21%2520Antibody-Immunohistochemistry-NBP2-31875-img0002.jpg)