PGLYRP2/PGRP-L Antibody
| Name | PGLYRP2/PGRP-L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31930 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: VWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PGLYRP2/PGRP-L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PGLYRP2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: PGLYRP2/PGRP-L Antibody [NBP2-31930] - Immunohistochemical staining of human liver shows distinct cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/12564_PGLYRP2-PGRP-L-Antibody-Immunohistochemistry-NBP2-31930-img0004.jpg)
Immunohistochemistry: PGLYRP2/PGRP-L Antibody [NBP2-31930] - Immunohistochemical staining of human liver shows distinct cytoplasmic positivity in hepatocytes.
![Immunohistochemistry: PGLYRP2/PGRP-L Antibody [NBP2-31930] - Immunohistochemical staining of human liver shows distinct cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/12565_PGLYRP2-PGRP-L-Antibody-Immunohistochemistry-NBP2-31930-img0003.jpg)
Immunohistochemistry: PGLYRP2/PGRP-L Antibody [NBP2-31930] - Immunohistochemical staining of human liver shows distinct cytoplasmic positivity in hepatocytes.