Zinc finger protein 790 Antibody
| Name | Zinc finger protein 790 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31816 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: CKKSSHIFSHHSYFTEQKIHNSANLCEWTDYGNTFSHESNFAQHQNIYTFEKSYEFKDFEKA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Zinc finger protein 790 Protein |
| Description | Rabbit Polyclonal |
| Gene | ZNF790 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Zinc finger protein 790 Antibody [NBP2-31816] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in subset of cells in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/12578_Zinc-finger-protein-790-Antibody-Immunohistochemistry-NBP2-31816-img0001.jpg)
Immunohistochemistry: Zinc finger protein 790 Antibody [NBP2-31816] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in subset of cells in glandular cells.
![Immunohistochemistry: Zinc finger protein 790 Antibody [NBP2-31816] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in subset of cells in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/12579_Zinc%2520finger%2520protein%2520790%2520Antibody-Immunohistochemistry-NBP2-31816-img0002.jpg)
Immunohistochemistry: Zinc finger protein 790 Antibody [NBP2-31816] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in subset of cells in glandular cells.