CCDC106 Antibody
| Name | CCDC106 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30390 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CCDC106 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CCDC106 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CCDC106 Antibody [NBP2-30390] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6376_CCDC106-Antibody-Western-Blot-NBP2-30390-img0001.jpg)
Western Blot: CCDC106 Antibody [NBP2-30390] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: CCDC106 Antibody [NBP2-30390] - Staining of human cell line HEK 293 shows positivity in nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6377_CCDC106-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30390-img0003.jpg)
Immunocytochemistry/Immunofluorescence: CCDC106 Antibody [NBP2-30390] - Staining of human cell line HEK 293 shows positivity in nucleus.
![Immunohistochemistry: CCDC106 Antibody [NBP2-30390] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6378_CCDC106-Antibody-Immunohistochemistry-NBP2-30390-img0002.jpg)
Immunohistochemistry: CCDC106 Antibody [NBP2-30390] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.