APOA1BP Antibody
| Name | APOA1BP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30626 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | APOA1BP Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | APOA1BP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: APOA1BP Antibody [NBP2-30626] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5765_APOA1BP-Antibody-Western-Blot-NBP2-30626-img0001.jpg)
Western Blot: APOA1BP Antibody [NBP2-30626] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
![Immunocytochemistry/Immunofluorescence: APOA1BP Antibody [NBP2-30626] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5766_APOA1BP%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30626-img0004.jpg)
Immunocytochemistry/Immunofluorescence: APOA1BP Antibody [NBP2-30626] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30626] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5767_APOA1BP-Antibody-Immunohistochemistry-Paraffin-NBP2-30626-img0003.jpg)
Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30626] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.