LRTM2 Antibody

Name LRTM2 Antibody
Supplier Novus Biologicals
Catalog NBP2-30649
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: NNSIRTLDRDLLRHSPLLRHLDLSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDNPWECDCNLREFKHWME
Purity/Format Immunogen affinity purified
Blocking Peptide LRTM2 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene LRTM2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.