RPL18A Antibody
| Name | RPL18A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30708 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RPL18A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RPL18A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RPL18A Antibody [NBP2-30708] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5576_RPL18A-Antibody-Western-Blot-NBP2-30708-img0001.jpg)
Western Blot: RPL18A Antibody [NBP2-30708] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: RPL18A Antibody [NBP2-30708] - Staining of human cell line U-2 OS shows localization to nucleoli, cytosol & endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5577_RPL18A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30708-img0004.jpg)
Immunocytochemistry/Immunofluorescence: RPL18A Antibody [NBP2-30708] - Staining of human cell line U-2 OS shows localization to nucleoli, cytosol & endoplasmic reticulum.
![Immunohistochemistry: RPL18A Antibody [NBP2-30708] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells, islets of Langerhans were negative.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5578_RPL18A-Antibody-Immunohistochemistry-NBP2-30708-img0002.jpg)
Immunohistochemistry: RPL18A Antibody [NBP2-30708] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells, islets of Langerhans were negative.