ARMCX6 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-30809
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: SKCLFIQGKLLFAEPKDAGFPFSQDINSHLASLSMARNTSPTPDPTVREALCAPDNLNASIESQGQIKMYINEVCRETVSRCC
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: ARMCX6 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: ARMCX6
• Conjugate: Unconjugated

Product images

Western Blot: ARMCX6 Antibody [NBP2-30809] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue

Immunocytochemistry/Immunofluorescence: ARMCX6 Antibody [NBP2-30809] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.

Immunohistochemistry-Paraffin: ARMCX6 Antibody [NBP2-30809] - Staining of human rectum shows strong cytoplasmic positivity in goblet cells.