CRTAM Antibody
| Name | CRTAM Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31019 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CRTAM Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CRTAM |
| Supplier Page | Shop |
Product images
![Western Blot: CRTAM Antibody [NBP2-31019] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/3824_CRTAM-Antibody-Western-Blot-NBP2-31019-img0001.jpg)
Western Blot: CRTAM Antibody [NBP2-31019] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Immunohistochemistry: CRTAM Antibody [NBP2-31019] - Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/3825_CRTAM-Antibody-Immunohistochemistry-NBP2-31019-img0002.jpg)
Immunohistochemistry: CRTAM Antibody [NBP2-31019] - Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.