Beta-endorphin Antibody
| Name | Beta-endorphin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NB120-10339 |
| Prices | $229.00 |
| Sizes | 50 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Rat |
| Antigen | Antiserum to beta Endorphin was raised in rabbits by using the N-terminal portion of bovine beta Endorphin conjugated to thyroglobulin. (YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE) |
| Purity/Format | Unpurified |
| Description | Rabbit Polyclonal |
| Gene | Pomc |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Beta-endorphin Antibody [NB120-10339] - Detection of beta-Endorphin (dark-blue varicosities and processes) in rat pituitary (HRP-DAB-with Ni enhancement).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6572_Beta-endorphin-Antibody-Immunohistochemistry-NB120-10339-img0001.jpg)
Immunohistochemistry: Beta-endorphin Antibody [NB120-10339] - Detection of beta-Endorphin (dark-blue varicosities and processes) in rat pituitary (HRP-DAB-with Ni enhancement).