FKBPL Antibody

Name FKBPL Antibody
Supplier Novus Biologicals
Catalog NBP1-56433
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FKBPL (FK506 binding protein like) The peptide sequence was selected from the N terminal of FKBPL)(50ug). Peptide sequence METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FKBPL
Conjugate Unconjugated
Supplier Page Shop

Product images