C4orf46 Antibody

Name C4orf46 Antibody
Supplier Novus Biologicals
Catalog NBP1-56427
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LOC201725(hypothetical protein LOC201725) The peptide sequence was selected from the middle region of LOC201725. Peptide sequence VSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATSAVSAQVEEL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C4orf46
Conjugate Unconjugated
Supplier Page Shop

Product images