CAPZA3 Antibody

Name CAPZA3 Antibody
Supplier Novus Biologicals
Catalog NBP1-56416
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CAPZA3(capping protein (actin filament) muscle Z-line, alpha 3) The peptide sequence was selected from the N terminal of CAPZA3. Peptide sequence MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CAPZA3
Conjugate Unconjugated
Supplier Page Shop

Product images