C11orf46 Antibody
| Name | C11orf46 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56478 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C11ORF46 The peptide sequence was selected from the N terminal of C11ORF46. Peptide sequence SSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ARL14EP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C11orf46 Antibody [NBP1-56478] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16989_C11orf46%2520Antibody-Western%2520Blot-NBP1-56478-img0002.jpg)
Western Blot: C11orf46 Antibody [NBP1-56478] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.