RSPH10B Antibody

Name RSPH10B Antibody
Supplier Novus Biologicals
Catalog NBP1-56466
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RSPH10B(radial spoke head 10 homolog B (Chlamydomonas)) The peptide sequence was selected from the middle region of RSPH10B. Peptide sequence EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RSPH10B
Conjugate Unconjugated
Supplier Page Shop

Product images