FAM13C1 Antibody
| Name | FAM13C1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56524 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FAM13C1(family with sequence similarity 13, member C1) The peptide sequence was selected from the N terminal of FAM13C1. Peptide sequence TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FAM13C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: FAM13C1 Antibody [NBP1-56524] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24212_FAM13C1-Antibody-Western-Blot-NBP1-56524-img0003.jpg)
![Western Blot: FAM13C1 Antibody [NBP1-56524] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24213_FAM13C1-Antibody-Western-Blot-NBP1-56524-img0002.jpg)
![Western Blot: FAM13C1 Antibody [NBP1-56524] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24214_FAM13C1%2520Antibody-Western%2520Blot-NBP1-56524-img0004.jpg)