CYP27C1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56523
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CYP27C1(cytochrome P450, family 27, subfamily C, polypeptide 1) The peptide sequence was selected from the middle region of CYP27C1. Peptide sequence VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CYP27C1
• Conjugate: Unconjugated