RTDR1 Antibody

Name RTDR1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56493
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RTDR1(rhabdoid tumor deletion region gene 1) The peptide sequence was selected from the N terminal of RTDR1. Peptide sequence MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMAL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RSPH14
Conjugate Unconjugated
Supplier Page Shop

Product images