DCAF12 Antibody

Name DCAF12 Antibody
Supplier Novus Biologicals
Catalog NBP1-56584
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to WDR40A(WD repeat domain 40A) The peptide sequence was selected from the middle region of WDR40A. Peptide sequence TKSDARHNVSRVPVYAHITHKALKDIPKEDTNPDNCKVRALAFNNKNKEL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DCAF12
Conjugate Unconjugated
Supplier Page Shop

Product images