THG1L Antibody

Name THG1L Antibody
Supplier Novus Biologicals
Catalog NBP1-56583
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to THG1L(tRNA-histidine guanylyltransferase 1-like (S. cerevisiae)) The peptide sequence was selected from the middle region of THG1L. Peptide sequence DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene THG1L
Conjugate Unconjugated
Supplier Page Shop

Product images