KIAA0907 Antibody

Name KIAA0907 Antibody
Supplier Novus Biologicals
Catalog NBP1-56565
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KIAA0907(KIAA0907) The peptide sequence was selected from the middle region of KIAA0907. Peptide sequence ELPDERESGLLGYQHGPIHMTNLGTGFSSQNEIEGAGSKPASSSGKERER.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KIAA0907
Conjugate Unconjugated
Supplier Page Shop

Product images