C21orf91 Antibody

Name C21orf91 Antibody
Supplier Novus Biologicals
Catalog NBP1-56533
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C21ORF91 The peptide sequence was selected from the middle region of C21ORF91. Peptide sequence QGCPRSKLSKSTYEEVKTILSKKINWIVQYAQNKDLDSDSECSKNPQHHL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C21orf91
Conjugate Unconjugated
Supplier Page Shop

Product images