NADKD1 Antibody
| Name | NADKD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56734 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | Synthetic peptides corresponding to NADKD1 The peptide sequence was selected from the middle region of NADKD1. Peptide sequence RWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEA. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NADK2 |
| Supplier Page | Shop |
Product images
![Western Blot: NADKD1 Antibody [NBP1-56734] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/13778_NADKD1%2520Antibody-Western%2520Blot-NBP1-56734-img0003.jpg)
Western Blot: NADKD1 Antibody [NBP1-56734] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.