FAM46D Antibody

Name FAM46D Antibody
Supplier Novus Biologicals
Catalog NBP1-56728
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Bovine
Antigen Synthetic peptides corresponding to FAM46D(family with sequence similarity 46, member D) The peptide sequence was selected from the middle region of FAM46D. Peptide sequence LPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGM.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene FAM46D
Supplier Page Shop

Product images