PACRGL Antibody
| Name | PACRGL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56717 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Synthetic peptides corresponding to C4ORF28 The peptide sequence was selected from the middle region of C4ORF28. Peptide sequence PPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLL. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PACRGL |
| Supplier Page | Shop |
Product images
![Western Blot: PACRGL Antibody [NBP1-56717] - Human Small Intestine, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/13781_PACRGL%2520Antibody-Western%2520Blot-NBP1-56717-img0002.jpg)
Western Blot: PACRGL Antibody [NBP1-56717] - Human Small Intestine, concentration 0.2-1 ug/ml.