THAP5 Antibody
| Name | THAP5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56750 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to THAP5(THAP domain containing 5) The peptide sequence was selected from the middle region of THAP5. Peptide sequence TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | THAP5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: THAP5 Antibody [NBP1-56750] - Human Placenta lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14826_THAP5%2520Antibody-Western%2520Blot-NBP1-56750-img0002.jpg)
Western Blot: THAP5 Antibody [NBP1-56750] - Human Placenta lysate, concentration 0.2-1 ug/ml.