DPH4 Antibody

Name DPH4 Antibody
Supplier Novus Biologicals
Catalog NBP1-56748
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DPH4 The peptide sequence was selected from the N terminal of DPH4. Peptide sequence MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DNAJC24
Conjugate Unconjugated
Supplier Page Shop

Product images