Name | MAGEB2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56838 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to MAGEB2(melanoma antigen family B, 2) The peptide sequence was selected from the N terminal of MAGEB2 (NP_002355). Peptide sequence MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | MAGEB2 |
Conjugate | Unconjugated |
Supplier Page | Shop |