MAGEB2 Antibody

Name MAGEB2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56838
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MAGEB2(melanoma antigen family B, 2) The peptide sequence was selected from the N terminal of MAGEB2 (NP_002355). Peptide sequence MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MAGEB2
Conjugate Unconjugated
Supplier Page Shop

Product images