p33MONOX Antibody

Name p33MONOX Antibody
Supplier Novus Biologicals
Catalog NBP1-56834
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KIAA1191(KIAA1191) The peptide sequence was selected from the middle region of KIAA1191. Peptide sequence TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KIAA1191
Conjugate Unconjugated
Supplier Page Shop

Product images