GRSF1 Antibody

Name GRSF1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57315
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GRSF1 (G-rich RNA sequence binding factor 1) The peptide sequence was selected from the N terminal of GRSF1. Peptide sequence SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene GRSF1
Conjugate Unconjugated
Supplier Page Shop

Product images