Name | GRSF1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57315 |
Prices | $299.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to GRSF1 (G-rich RNA sequence binding factor 1) The peptide sequence was selected from the N terminal of GRSF1. Peptide sequence SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | GRSF1 |
Conjugate | Unconjugated |
Supplier Page | Shop |