MRPL24 Antibody

Name MRPL24 Antibody
Supplier Novus Biologicals
Catalog NBP1-57354
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Dog
Antigen Synthetic peptides corresponding to MRPL24(mitochondrial ribosomal protein L24) The peptide sequence was selected from the N terminal of MRPL24. Peptide sequence RRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVG.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene MRPL24
Supplier Page Shop

Product images