DDX31 Antibody

Name DDX31 Antibody
Supplier Novus Biologicals
Catalog NBP1-57349
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DDX31 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 31) The peptide sequence was selected from the N terminal of DDX31. Peptide sequence QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene DDX31
Conjugate Unconjugated
Supplier Page Shop

Product images