Name | TRSPAP1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57445 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to TRSPAP1(tRNA selenocysteine associated protein 1) The peptide sequence was selected from the middle region of TRSPAP1. Peptide sequence KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTM. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | TRNAU1AP |
Conjugate | Unconjugated |
Supplier Page | Shop |