TRSPAP1 Antibody

Name TRSPAP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57445
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRSPAP1(tRNA selenocysteine associated protein 1) The peptide sequence was selected from the middle region of TRSPAP1. Peptide sequence KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTM.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene TRNAU1AP
Conjugate Unconjugated
Supplier Page Shop

Product images