PABPC1L2A Antibody

Name PABPC1L2A Antibody
Supplier Novus Biologicals
Catalog NBP1-57529
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PABPC1L2A(poly(A) binding protein, cytoplasmic 1-like 2A) The peptide sequence was selected from the middle region of PABPC1L2A. Peptide sequence NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PABPC1L2A
Conjugate Unconjugated
Supplier Page Shop

Product images