DCAF4 Antibody
| Name | DCAF4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52862 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to WDR21A(WD repeat domain 21A) The peptide sequence was selected from the middle region of WDR21A. Peptide sequence GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DCAF4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: DCAF4 Antibody [NBP1-52862] - Jurkat, Antibody Dilution: 1.0 ug/ml DCAF4 is supported by BioGPS gene expression data to be expressed in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24925_DCAF4%2520Antibody-Western%2520Blot-NBP1-52862-img0004.jpg)
![Western Blot: DCAF4 Antibody [NBP1-52862] - Human Muscle lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24926_DCAF4-Antibody-Western-Blot-NBP1-52862-img0003.jpg)