Name | POLR1D Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-52917 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Dog |
Antigen | Synthetic peptides corresponding to POLR1D(polymerase (RNA) I polypeptide D, 16kDa) The peptide sequence was selected from the middle region of POLR1D. Peptide sequence TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | POLR1D |
Supplier Page | Shop |