NUSAP1 Antibody

Name NUSAP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-53047
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NUSAP1(nucleolar and spindle associated protein 1) The peptide sequence was selected from the middle region of NUSAP1. Peptide sequence AENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NUSAP1
Conjugate Unconjugated
Supplier Page Shop

Product images