EEF1B2 Antibody

Name EEF1B2 Antibody
Supplier Novus Biologicals
Catalog NBP1-53035
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EEF1B2(eukaryotic translation elongation factor 1 beta 2) The peptide sequence was selected from the middle region of EEF1B2 (NP_066944). Peptide sequence VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene EEF1B2
Conjugate Unconjugated
Supplier Page Shop

Product images