Name | EEF1B2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-53035 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to EEF1B2(eukaryotic translation elongation factor 1 beta 2) The peptide sequence was selected from the middle region of EEF1B2 (NP_066944). Peptide sequence VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | EEF1B2 |
Conjugate | Unconjugated |
Supplier Page | Shop |