TSPAN1 Antibody

Name TSPAN1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54405
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TSPAN1 (tetraspanin 1) The peptide sequence was selected from the middle region of TSPAN1)(50ug). Peptide sequence TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TSPAN1
Conjugate Unconjugated
Supplier Page Shop

Product images