Calicin Antibody
| Name | Calicin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53182 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CCIN(calicin) The peptide sequence was selected from the C terminal of CCIN. Peptide sequence TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CCIN |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Calicin Antibody [NBP1-53182] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7303_Calicin%2520Antibody-Western%2520Blot-NBP1-53182-img0002.jpg)
Western Blot: Calicin Antibody [NBP1-53182] - Human Liver cell lysate, concentration 0.2-1 ug/ml.