RNF219 Antibody
| Name | RNF219 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55064 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C13ORF7 The peptide sequence was selected from the N terminal of C13ORF7. Peptide sequence LVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDKLKEANKKLKLENG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RNF219 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RNF219 Antibody [NBP1-55064] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17172_RNF219-Antibody-Western-Blot-NBP1-55064-img0003.jpg)
Western Blot: RNF219 Antibody [NBP1-55064] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.