Name | PEX26 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55115 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Bovine, Horse |
Antigen | Synthetic peptides corresponding to PEX26(peroxisomal biogenesis factor 26) The peptide sequence was selected from the middle region of PEX26. Peptide sequence ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | PEX26 |
Supplier Page | Shop |