INSL5 Antibody
| Name | INSL5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55379 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to INSL5(insulin-like 5) The peptide sequence was selected from the middle region of INSL5. Peptide sequence RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | INSL5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: INSL5 Antibody [NBP1-55379] - Hela cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7285_INSL5-Antibody-Western-Blot-NBP1-55379-img0002.jpg)
![Western Blot: INSL5 Antibody [NBP1-55379] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7286_INSL5%2520Antibody-Western%2520Blot-NBP1-55379-img0003.jpg)