IFN-alpha G/IFNA5 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57915
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to IFNA5(interferon, alpha 5) The peptide sequence was selected from the middle region of IFNA5. Peptide sequence TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: IFNA5
• Conjugate: Unconjugated