RNASE11 Antibody

Name RNASE11 Antibody
Supplier Novus Biologicals
Catalog NBP1-57953
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RNASE11(ribonuclease, RNase A family, 11 (non-active)) The peptide sequence was selected from the middle region of RNASE11. Peptide sequence GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RNASE11
Conjugate Unconjugated
Supplier Page Shop

Product images